PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009126091.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 404aa    MW: 44797.1 Da    PI: 5.1977
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009126091.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK59.75.5e-19312362252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     + +++++d+s+  +lpi++AA++L +c+T++K+iCR+  + RWP+Rk++sl
  XP_009126091.1 312 TRSLTVKDMSELWDLPIEEAARKLRICTTAVKKICRRGEVFRWPRRKLASL 362
                     6789********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.369302383IPR003035RWP-RK domain
PfamPF020427.9E-17314362IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MAGGDPKPIA LQDNEDEDIF YDAYSEEYLM SLMSNPNPNL MDLPFSKNTL LAPPPAPALE  60
INRTALLGDP SVSNPHGDTI KEYLKSLRID DGSLTVNTSD ALSDDINEYI DYTDLGEIGN  120
ENVGESGILQ ANAHVFAENT MNFETGGASA MPVPVITPTP TISQGLFLCT YCNLLRQLVH  180
ANGQEMMRLD LFGGIGYFCH AVIETRRFDG SNELRYQMNL KMEDVKKFIE DYCAARAAGG  240
FVIMQDTNAD FYQAMNACTT SSQLLMSTLP PRVDIPMSLA VPNESLNVAS VPPAVKGKPR  300
RQTNLSAQRK RTRSLTVKDM SELWDLPIEE AARKLRICTT AVKKICRRGE VFRWPRRKLA  360
SLREKVAALK IVVSQSTDAG VRARAEVKIE NFEKQIDAIY SKAR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1342358KKICRRGEVFRWPRRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.189480.0bud| flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2400870.0AC240087.1 Brassica oleracea clone BOT01-44D22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009126091.10.0PREDICTED: uncharacterized protein LOC103851025
TrEMBLA0A078HLD40.0A0A078HLD4_BRANA; BnaC02g06390D protein
TrEMBLA0A0D3AJA90.0A0A0D3AJA9_BRAOL; Uncharacterized protein
STRINGBra023551.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40762342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.17e-09RWP-RK domain-containing protein